Lineage for d2zrda2 (2zrd A:271-334)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946749Fold d.48: Anti-LPS factor/recA domain [54751] (2 superfamilies)
    alpha-beta(3)-alpha(2); 2 layers, alpha/beta
  4. 2946750Superfamily d.48.1: RecA protein, C-terminal domain [54752] (2 families) (S)
  5. 2946780Family d.48.1.0: automated matches [227236] (1 protein)
    not a true family
  6. 2946781Protein automated matches [226990] (3 species)
    not a true protein
  7. 2946786Species Mycobacterium smegmatis [TaxId:246196] [225585] (8 PDB entries)
  8. 2946790Domain d2zrda2: 2zrd A:271-334 [244974]
    Other proteins in same PDB: d2zrda1
    automated match to d2zrma2
    complexed with adp

Details for d2zrda2

PDB Entry: 2zrd (more details), 3.1 Å

PDB Description: msreca q196n adp form iv
PDB Compounds: (A:) Protein recA

SCOPe Domain Sequences for d2zrda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zrda2 d.48.1.0 (A:271-334) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
sregslidmgvehgfirksgswftyegeqlgqgkenarkfllentdvaneiekkikeklg
igav

SCOPe Domain Coordinates for d2zrda2:

Click to download the PDB-style file with coordinates for d2zrda2.
(The format of our PDB-style files is described here.)

Timeline for d2zrda2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2zrda1