Lineage for d1awja_ (1awj A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2782862Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2783129Protein IL-2 inducible T-cell (Itc) kinase [50060] (1 species)
  7. 2783130Species Mouse (Mus musculus) [TaxId:10090] [50061] (1 PDB entry)
  8. 2783131Domain d1awja_: 1awj A: [24497]

Details for d1awja_

PDB Entry: 1awj (more details)

PDB Description: intramolecular itk-proline complex, nmr, minimized average structure
PDB Compounds: (A:) itk

SCOPe Domain Sequences for d1awja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1awja_ b.34.2.1 (A:) IL-2 inducible T-cell (Itc) kinase {Mouse (Mus musculus) [TaxId: 10090]}
kkplpptpednrrsfqepeetlvialydyqtndpqelalrcdeeyylldsseihwwrvqd
knghegyapssylveks

SCOPe Domain Coordinates for d1awja_:

Click to download the PDB-style file with coordinates for d1awja_.
(The format of our PDB-style files is described here.)

Timeline for d1awja_: