Lineage for d1awja_ (1awj A:)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.34: SH3-like barrel [50036] (21 superfamilies)
barrel, partly opened; n*=4, S*=8; meander
the last strand is interrupted by a turn of 3-10 helix
Superfamily b.34.2: SH3-domain [50044] (2 families) 
Family b.34.2.1: SH3-domain [50045] (40 protein domains) 
Protein IL-2 inducible T-cell (Itc) kinase [50060] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [50061] (1 PDB entry) 
Domain d1awja_: 1awj A: [24497]
Details for d1awja_
PDB Entry: 1awj (more details)
PDB Description: intramolecular itk-proline complex, nmr, minimized average structure
PDB Compounds: (A:) itkSCOPe Domain Sequences for d1awja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1awja_ b.34.2.1 (A:) IL-2 inducible T-cell (Itc) kinase {Mouse (Mus musculus) [TaxId: 10090]}
kkplpptpednrrsfqepeetlvialydyqtndpqelalrcdeeyylldsseihwwrvqd
knghegyapssylveks
SCOPe Domain Coordinates for d1awja_:
Click to download the PDB-style file with coordinates for d1awja_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1awja_:
- d1awja_ first appeared (with stable ids) in SCOP 1.55, called d1awj__
- d1awja_ appears in SCOPe 2.06
View in 3D