![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.48: Anti-LPS factor/recA domain [54751] (2 superfamilies) alpha-beta(3)-alpha(2); 2 layers, alpha/beta |
![]() | Superfamily d.48.1: RecA protein, C-terminal domain [54752] (2 families) ![]() |
![]() | Family d.48.1.0: automated matches [227236] (1 protein) not a true family |
![]() | Protein automated matches [226990] (3 species) not a true protein |
![]() | Species Mycobacterium smegmatis [TaxId:246196] [225585] (8 PDB entries) |
![]() | Domain d2zr0a2: 2zr0 A:271-330 [244968] Other proteins in same PDB: d2zr0a1 automated match to d2zrma2 complexed with gol, po4; mutant |
PDB Entry: 2zr0 (more details), 3 Å
SCOPe Domain Sequences for d2zr0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zr0a2 d.48.1.0 (A:271-330) automated matches {Mycobacterium smegmatis [TaxId: 246196]} sregslidmgvehgfirksgswftyegeqlgqgkenarkfllentdvaneiekkikeklg
Timeline for d2zr0a2: