Lineage for d2zr0a2 (2zr0 A:271-330)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1648252Fold d.48: Anti-LPS factor/recA domain [54751] (2 superfamilies)
    alpha-beta(3)-alpha(2); 2 layers, alpha/beta
  4. 1648253Superfamily d.48.1: RecA protein, C-terminal domain [54752] (2 families) (S)
  5. 1648282Family d.48.1.0: automated matches [227236] (1 protein)
    not a true family
  6. 1648283Protein automated matches [226990] (2 species)
    not a true protein
  7. 1648288Species Mycobacterium smegmatis [TaxId:246196] [225585] (8 PDB entries)
  8. 1648292Domain d2zr0a2: 2zr0 A:271-330 [244968]
    Other proteins in same PDB: d2zr0a1
    automated match to d2zrma2
    complexed with gol, po4; mutant

Details for d2zr0a2

PDB Entry: 2zr0 (more details), 3 Å

PDB Description: msreca-q196e mutant
PDB Compounds: (A:) Protein recA

SCOPe Domain Sequences for d2zr0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zr0a2 d.48.1.0 (A:271-330) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
sregslidmgvehgfirksgswftyegeqlgqgkenarkfllentdvaneiekkikeklg

SCOPe Domain Coordinates for d2zr0a2:

Click to download the PDB-style file with coordinates for d2zr0a2.
(The format of our PDB-style files is described here.)

Timeline for d2zr0a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2zr0a1