Lineage for d2zoma_ (2zom A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2950563Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2950865Family d.58.5.0: automated matches [191474] (1 protein)
    not a true family
  6. 2950866Protein automated matches [190753] (21 species)
    not a true protein
  7. 2951033Species Oryza sativa [TaxId:39947] [255730] (1 PDB entry)
  8. 2951034Domain d2zoma_: 2zom A: [244962]
    automated match to d3opkc_
    complexed with gol, so4

Details for d2zoma_

PDB Entry: 2zom (more details), 3.02 Å

PDB Description: Crystal structure of CutA1 from Oryza sativa
PDB Compounds: (A:) Protein CutA, chloroplast, putative, expressed

SCOPe Domain Sequences for d2zoma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zoma_ d.58.5.0 (A:) automated matches {Oryza sativa [TaxId: 39947]}
sttvpsivvyvtvpnkeagkrlagsiiseklaacvnivpgiesvywwegkvqtdaeelli
iktreslldaltehvkanheydvpevialpikggnlkylewlknstr

SCOPe Domain Coordinates for d2zoma_:

Click to download the PDB-style file with coordinates for d2zoma_.
(The format of our PDB-style files is described here.)

Timeline for d2zoma_: