Lineage for d2znpb1 (2znp B:206-475)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009141Protein Peroxisome proliferator-activated receptor delta, PPAR-DELTA [48526] (1 species)
  7. 2009142Species Human (Homo sapiens) [TaxId:9606] [48527] (16 PDB entries)
  8. 2009171Domain d2znpb1: 2znp B:206-475 [244961]
    Other proteins in same PDB: d2znpb2
    automated match to d3tkma_
    protein/DNA complex; complexed with b7g, k55

Details for d2znpb1

PDB Entry: 2znp (more details), 3 Å

PDB Description: human ppar delta ligand binding domain in complex with a synthetic agonist tipp204
PDB Compounds: (B:) Peroxisome proliferator-activated receptor delta

SCOPe Domain Sequences for d2znpb1:

Sequence, based on SEQRES records: (download)

>d2znpb1 a.123.1.1 (B:206-475) Peroxisome proliferator-activated receptor delta, PPAR-DELTA {Human (Homo sapiens) [TaxId: 9606]}
pqvadlkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekglvwk
qlvnglppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvhea
ifamlasivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdla
lfiaaiilcgdrpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrql
vtehaqmmqrikktetetslhpllqeiykd

Sequence, based on observed residues (ATOM records): (download)

>d2znpb1 a.123.1.1 (B:206-475) Peroxisome proliferator-activated receptor delta, PPAR-DELTA {Human (Homo sapiens) [TaxId: 9606]}
pqvadlkafskhiynaylknfnmtkkkarsiltghtapfvihdietlwqaekglvwlppy
keisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifamlasiv
nkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaaiilc
gdrpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlvtehaqmmq
rikktetetslhpllqeiykd

SCOPe Domain Coordinates for d2znpb1:

Click to download the PDB-style file with coordinates for d2znpb1.
(The format of our PDB-style files is described here.)

Timeline for d2znpb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2znpb2
View in 3D
Domains from other chains:
(mouse over for more information)
d2znpa_