Lineage for d2znpa_ (2znp A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009141Protein Peroxisome proliferator-activated receptor delta, PPAR-DELTA [48526] (1 species)
  7. 2009142Species Human (Homo sapiens) [TaxId:9606] [48527] (16 PDB entries)
  8. 2009170Domain d2znpa_: 2znp A: [244960]
    Other proteins in same PDB: d2znpb2
    automated match to d3tkma_
    protein/DNA complex; complexed with b7g, k55

Details for d2znpa_

PDB Entry: 2znp (more details), 3 Å

PDB Description: human ppar delta ligand binding domain in complex with a synthetic agonist tipp204
PDB Compounds: (A:) Peroxisome proliferator-activated receptor delta

SCOPe Domain Sequences for d2znpa_:

Sequence, based on SEQRES records: (download)

>d2znpa_ a.123.1.1 (A:) Peroxisome proliferator-activated receptor delta, PPAR-DELTA {Human (Homo sapiens) [TaxId: 9606]}
lkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekglvwkqlvng
lppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifaml
asivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaa
iilcgdrpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlvteha
qmmqrikktetetslhpllqeiykdm

Sequence, based on observed residues (ATOM records): (download)

>d2znpa_ a.123.1.1 (A:) Peroxisome proliferator-activated receptor delta, PPAR-DELTA {Human (Homo sapiens) [TaxId: 9606]}
lkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekglvlppykei
svhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifamlasivnkd
gllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaaiilcgdr
pglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlvtehaqmmqrik
ktetetslhpllqeiykdm

SCOPe Domain Coordinates for d2znpa_:

Click to download the PDB-style file with coordinates for d2znpa_.
(The format of our PDB-style files is described here.)

Timeline for d2znpa_: