Class b: All beta proteins [48724] (144 folds) |
Fold b.34: SH3-like barrel [50036] (15 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (1 family) |
Family b.34.2.1: SH3-domain [50045] (35 proteins) |
Protein alpha-Spectrin, SH3 domain [50058] (1 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [50059] (17 PDB entries) |
Domain d1aey__: 1aey - [24496] |
PDB Entry: 1aey (more details)
SCOP Domain Sequences for d1aey__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aey__ b.34.2.1 (-) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus)} gkelvlalydyqeksprevtmkkgdiltllnstnkdwwkvevndrqgfvpaayvkkld
Timeline for d1aey__: