SCOPe 2.05: Domain d2zmxb_: 2zmx B:

Lineage for d2zmxb_ (2zmx B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.386: Tyrosinase cofactor MelC1-like [254118] (1 superfamily)
   2 layers: a/b; antiparallel beta-sheet of 6 strands partly surrounding one helix. Fold-level similarity and potential homology to SH2 domains (d.93) noted in PubMed 16436386

4. Superfamily d.386.1: Tyrosinase cofactor MelC1 [254141] (1 family)
   Pfam PF06236

5. Family d.386.1.1: Tyrosinase cofactor MelC1 [254186] (1 protein)

6. Protein Tyrosinase cofactor MelC1 [254410] (1 species)

7. Species Streptomyces castaneoglobisporus [TaxId:79261] [254849] (22 PDB entries)

8. Domain d2zmxb_: 2zmx B: [244954]
   Other proteins in same PDB: d2zmxa_
   automated match to d2ahkb_
   complexed with cu, no3

Details for d2zmxb_

PDB Entry: 2zmx, 1.33 Å

PDB Description: Crystal structure of the met1-form of the copper-bound tyrosinase in complex with a caddie protein from Streptomyces castaneoglobisporus obtained by soaking in cupric sulfate solution for 36 hours

PDB Compounds: (B:) caddie

SCOPe Domain Sequences for d2zmxb_:

Sequence, based on SEQRES records:

>d2zmxb_ d.386.1.1 (B:) Tyrosinase cofactor MelC1 {Streptomyces castaneoglobisporus [TaxId: 79261]}
aapesfdevykgrriqgrpargaahhhehgggyevfvdgvqlhvmrnadgswisvvshyd
pvptpraaaraavdelqgapllp

Sequence, based on observed residues (ATOM records):

>d2zmxb_ d.386.1.1 (B:) Tyrosinase cofactor MelC1 {Streptomyces castaneoglobisporus [TaxId: 79261]}
aapesfdevykgrriqgrpahehgggyevfvdgvqlhvmrnadgswisvvshydpvptpr
aaaraavdelqgapllp

Timeline for d2zmxb_:

• d2zmxb_ first appeared in SCOPe 2.04
  
• d2zmxb_ appears in SCOPe 2.06
  
• d2zmxb_ appears in the current release, SCOPe 2.08