Lineage for d1qkwa_ (1qkw A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1783288Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1783415Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1783416Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 1783440Protein alpha-Spectrin, SH3 domain [50058] (1 species)
  7. 1783441Species Chicken (Gallus gallus) [TaxId:9031] [50059] (34 PDB entries)
  8. 1783456Domain d1qkwa_: 1qkw A: [24494]
    complexed with gol, so4; mutant

Details for d1qkwa_

PDB Entry: 1qkw (more details), 2 Å

PDB Description: alpha-spectrin src homology 3 domain, n47g mutant in the distal loop.
PDB Compounds: (A:) alpha II spectrin

SCOPe Domain Sequences for d1qkwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qkwa_ b.34.2.1 (A:) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]}
kelvlalydyqeksprevtmkkgdiltllnstnkdwwkvevgdrqgfvpaayvkkld

SCOPe Domain Coordinates for d1qkwa_:

Click to download the PDB-style file with coordinates for d1qkwa_.
(The format of our PDB-style files is described here.)

Timeline for d1qkwa_: