Class a: All alpha proteins [46456] (285 folds) |
Fold a.6: Putative DNA-binding domain [46954] (1 superfamily) core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different |
Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families) |
Family a.6.1.0: automated matches [191604] (1 protein) not a true family |
Protein automated matches [191102] (2 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [255728] (1 PDB entry) |
Domain d2zhga_: 2zhg A: [244924] automated match to d1q05b_ protein/DNA complex; complexed with dtt, fes, gol |
PDB Entry: 2zhg (more details), 2.8 Å
SCOPe Domain Sequences for d2zhga_:
Sequence, based on SEQRES records: (download)
>d2zhga_ a.6.1.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]} alltpgevakrsgvavsalhfyeskglitsirnsgnqrrykrdvlryvaiikiaqrigip latigeafgvlpeghtlsakewkqlssqwreeldrrihtlvalrdeldgcigcgclsrsd cplrnp
>d2zhga_ a.6.1.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]} alltpgevakrsgvavsalhfyeskglitsirnsgnqrrykrdvlryvaiikiaqrigip latigeafgvtlsakewkqlssqwreeldrrihtlvalrdeldgcigcgclsrsdcplrn p
Timeline for d2zhga_: