Lineage for d2zhga_ (2zhg A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1481235Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
    core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different
  4. 1481236Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families) (S)
  5. 1481349Family a.6.1.0: automated matches [191604] (1 protein)
    not a true family
  6. 1481350Protein automated matches [191102] (2 species)
    not a true protein
  7. 1481351Species Escherichia coli K-12 [TaxId:83333] [255728] (1 PDB entry)
  8. 1481352Domain d2zhga_: 2zhg A: [244924]
    automated match to d1q05b_
    protein/DNA complex; complexed with dtt, fes, gol

Details for d2zhga_

PDB Entry: 2zhg (more details), 2.8 Å

PDB Description: Crystal structure of SoxR in complex with DNA
PDB Compounds: (A:) Redox-sensitive transcriptional activator soxR

SCOPe Domain Sequences for d2zhga_:

Sequence, based on SEQRES records: (download)

>d2zhga_ a.6.1.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
alltpgevakrsgvavsalhfyeskglitsirnsgnqrrykrdvlryvaiikiaqrigip
latigeafgvlpeghtlsakewkqlssqwreeldrrihtlvalrdeldgcigcgclsrsd
cplrnp

Sequence, based on observed residues (ATOM records): (download)

>d2zhga_ a.6.1.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
alltpgevakrsgvavsalhfyeskglitsirnsgnqrrykrdvlryvaiikiaqrigip
latigeafgvtlsakewkqlssqwreeldrrihtlvalrdeldgcigcgclsrsdcplrn
p

SCOPe Domain Coordinates for d2zhga_:

Click to download the PDB-style file with coordinates for d2zhga_.
(The format of our PDB-style files is described here.)

Timeline for d2zhga_: