SCOPe 2.08: Domain d2zhga_: 2zhg A:

Lineage for d2zhga_ (2zhg A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
   core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different

4. Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families)

5. Family a.6.1.0: automated matches [191604] (1 protein)
   not a true family

6. Protein automated matches [191102] (6 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [255728] (1 PDB entry)

8. Domain d2zhga_: 2zhg A: [244924]
   automated match to d1q05b_
   protein/DNA complex; complexed with dtt, fes, gol

Details for d2zhga_

PDB Entry: 2zhg, 2.8 Å

PDB Description: Crystal structure of SoxR in complex with DNA

PDB Compounds: (A:) Redox-sensitive transcriptional activator soxR

SCOPe Domain Sequences for d2zhga_:

Sequence, based on SEQRES records:

>d2zhga_ a.6.1.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
alltpgevakrsgvavsalhfyeskglitsirnsgnqrrykrdvlryvaiikiaqrigip
latigeafgvlpeghtlsakewkqlssqwreeldrrihtlvalrdeldgcigcgclsrsd
cplrnp

Sequence, based on observed residues (ATOM records):

>d2zhga_ a.6.1.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
alltpgevakrsgvavsalhfyeskglitsirnsgnqrrykrdvlryvaiikiaqrigip
latigeafgvtlsakewkqlssqwreeldrrihtlvalrdeldgcigcgclsrsdcplrn
p

Timeline for d2zhga_:

• d2zhga_ first appeared in SCOPe 2.04
  
• d2zhga_ appears in SCOPe 2.07