| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
| Protein automated matches [190437] (70 species) not a true protein |
| Species Agrocybe aegerita [TaxId:5400] [231694] (18 PDB entries) |
| Domain d2zgnb_: 2zgn B: [244922] automated match to d2zgla_ complexed with gal |
PDB Entry: 2zgn (more details), 2.5 Å
SCOPe Domain Sequences for d2zgnb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zgnb_ b.29.1.0 (B:) automated matches {Agrocybe aegerita [TaxId: 5400]}
qgvniynisagtsvdlaapvttgdivtffssalnlnagagnpnnttlnlfaengayllhi
afrlqenviifnsrqpdgpwlveqrvsdvanqfagidgkamvtvfdhgdkyqvvinektv
iqytkqisgltsslsynateetsifstvveavtytgla
Timeline for d2zgnb_: