Lineage for d2zfbb_ (2zfb B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1715807Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1717797Protein automated matches [190359] (40 species)
    not a true protein
  7. 1718054Species Psittacula krameri [TaxId:9228] [255724] (1 PDB entry)
  8. 1718056Domain d2zfbb_: 2zfb B: [244919]
    automated match to d1a4fb_
    complexed with hem

Details for d2zfbb_

PDB Entry: 2zfb (more details), 3 Å

PDB Description: crystal structure of parrot hemoglobin (psittacula krameri) at ph 7.5
PDB Compounds: (B:) Hemoglobin subunit beta

SCOPe Domain Sequences for d2zfbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zfbb_ a.1.1.2 (B:) automated matches {Psittacula krameri [TaxId: 9228]}
vhwsaeekqlitglwgkvnvaecgaealarllivypwtqrfftsfgnlssasavlgnpnv
rahgkkvltsfgeavknldnikntfaqlselhcdklhvdpenfrllgdiliivlaghfgk
dftpdcqaawqklvravahalarkyh

SCOPe Domain Coordinates for d2zfbb_:

Click to download the PDB-style file with coordinates for d2zfbb_.
(The format of our PDB-style files is described here.)

Timeline for d2zfbb_: