SCOPe 2.07: Domain d2zfbb_: 2zfb B:

Lineage for d2zfbb_ (2zfb B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 protein domains)
   Heme-binding protein

6. Protein automated matches [190359] (42 species)
   not a true protein

7. Species Psittacula krameri [TaxId:9228] [255724] (1 PDB entry)

8. Domain d2zfbb_: 2zfb B: [244919]
   automated match to d1a4fb_
   complexed with hem

Details for d2zfbb_

PDB Entry: 2zfb, 3 Å

PDB Description: crystal structure of parrot hemoglobin (psittacula krameri) at ph 7.5

PDB Compounds: (B:) Hemoglobin subunit beta

SCOPe Domain Sequences for d2zfbb_:

Sequence; same for both SEQRES and ATOM records:

>d2zfbb_ a.1.1.2 (B:) automated matches {Psittacula krameri [TaxId: 9228]}
vhwsaeekqlitglwgkvnvaecgaealarllivypwtqrfftsfgnlssasavlgnpnv
rahgkkvltsfgeavknldnikntfaqlselhcdklhvdpenfrllgdiliivlaghfgk
dftpdcqaawqklvravahalarkyh

Timeline for d2zfbb_:

• d2zfbb_ first appeared in SCOPe 2.04
  
• d2zfbb_ appears in SCOPe 2.06