Lineage for d2zfba_ (2zfb A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2688401Protein automated matches [190359] (43 species)
    not a true protein
  7. 2688772Species Psittacula krameri [TaxId:9228] [255724] (1 PDB entry)
  8. 2688773Domain d2zfba_: 2zfb A: [244918]
    automated match to d3fs4a_
    complexed with hem

Details for d2zfba_

PDB Entry: 2zfb (more details), 3 Å

PDB Description: crystal structure of parrot hemoglobin (psittacula krameri) at ph 7.5
PDB Compounds: (A:) Hemoglobin subunit alpha

SCOPe Domain Sequences for d2zfba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zfba_ a.1.1.2 (A:) automated matches {Psittacula krameri [TaxId: 9228]}
vlsgtdktnvksifskiggqaddygaealermfvtypqtktyfphfdvspgsaqvkahgk
kvagglseaanhiddiatslsklsdlhaqklrvdpvnfkllgqcflvvvaihnpsaltpe
ahasldkflcavglvltakyr

SCOPe Domain Coordinates for d2zfba_:

Click to download the PDB-style file with coordinates for d2zfba_.
(The format of our PDB-style files is described here.)

Timeline for d2zfba_: