| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
| Protein automated matches [190359] (43 species) not a true protein |
| Species Psittacula krameri [TaxId:9228] [255724] (1 PDB entry) |
| Domain d2zfba_: 2zfb A: [244918] automated match to d3fs4a_ complexed with hem |
PDB Entry: 2zfb (more details), 3 Å
SCOPe Domain Sequences for d2zfba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zfba_ a.1.1.2 (A:) automated matches {Psittacula krameri [TaxId: 9228]}
vlsgtdktnvksifskiggqaddygaealermfvtypqtktyfphfdvspgsaqvkahgk
kvagglseaanhiddiatslsklsdlhaqklrvdpvnfkllgqcflvvvaihnpsaltpe
ahasldkflcavglvltakyr
Timeline for d2zfba_: