Lineage for d2zeta_ (2zet A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1845934Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1846518Protein Rab27b [142263] (2 species)
  7. 1846522Species Mouse (Mus musculus) [TaxId:10090] [256388] (1 PDB entry)
  8. 1846523Domain d2zeta_: 2zet A: [244916]
    automated match to d2f9ma_
    complexed with gtp, mg, so4, zn

Details for d2zeta_

PDB Entry: 2zet (more details), 3 Å

PDB Description: crystal structure of the small gtpase rab27b complexed with the slp homology domain of slac2-a/melanophilin
PDB Compounds: (A:) Ras-related protein Rab-27B

SCOPe Domain Sequences for d2zeta_:

Sequence, based on SEQRES records: (download)

>d2zeta_ c.37.1.8 (A:) Rab27b {Mouse (Mus musculus) [TaxId: 10090]}
dydylikllalgdsgvgkttflyrytdnkfnpkfittvgidfrekrvvydtqgadgasgk
afkvhlqlwdtaglerfrslttaffrdamgfllmfdltsqqsflnvrnwmsqlqanayce
npdivlignkadlpdqrevnerqarelaekygipyfetsaatgqnveksvetlldlimkr
mekc

Sequence, based on observed residues (ATOM records): (download)

>d2zeta_ c.37.1.8 (A:) Rab27b {Mouse (Mus musculus) [TaxId: 10090]}
dydylikllalgdsgvgkttflyrytdnkfnpkfittvgidfrekrvvydtqgasgkafk
vhlqlwdtaglerfrslttaffrdamgfllmfdltsqqsflnvrnwmsqlqanaycenpd
ivlignkadlpdqrevnerqarelaekygipyfetsaatgqnveksvetlldlimkrmek
c

SCOPe Domain Coordinates for d2zeta_:

Click to download the PDB-style file with coordinates for d2zeta_.
(The format of our PDB-style files is described here.)

Timeline for d2zeta_: