![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
![]() | Superfamily a.29.5: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69012] (2 families) ![]() automatically mapped to Pfam PF10436 |
![]() | Family a.29.5.0: automated matches [230678] (1 protein) not a true family |
![]() | Protein automated matches [230679] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [230680] (8 PDB entries) |
![]() | Domain d2zdxa1: 2zdx A:20-187 [244908] Other proteins in same PDB: d2zdxa2, d2zdxb2 automated match to d2e0ab1 complexed with p4a |
PDB Entry: 2zdx (more details), 2.54 Å
SCOPe Domain Sequences for d2zdxa1:
Sequence, based on SEQRES records: (download)
>d2zdxa1 a.29.5.0 (A:20-187) automated matches {Human (Homo sapiens) [TaxId: 9606]} vprevehfsryspsplsmkqlldfgsenacertsfaflrqelpvrlanilkeidilptql vntssvqlvkswyiqslmdlvefhekspddqkalsdfvdtlikvrnrhhnvvptmaqgii eykdactvdpvtnqnlqyfldrfymnristrmlmnqhilifsdsqtgn
>d2zdxa1 a.29.5.0 (A:20-187) automated matches {Human (Homo sapiens) [TaxId: 9606]} vprevehfsryspsplsmkqlldfgsenacertsfaflrqelpvrlanilkeidilptql vntssvqlvkswyiqslmdlvefhekspddqkalsdfvdtlikvrnrhhnvvptmaqgii eynqnlqyfldrfymnristrmlmnqhilifsdsqtgn
Timeline for d2zdxa1: