![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (15 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.2: SH3-domain [50044] (1 family) ![]() |
![]() | Family b.34.2.1: SH3-domain [50045] (37 proteins) |
![]() | Protein alpha-Spectrin, SH3 domain [50058] (1 species) |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [50059] (17 PDB entries) |
![]() | Domain d1pwt__: 1pwt - [24490] mutant |
PDB Entry: 1pwt (more details), 1.77 Å
SCOP Domain Sequences for d1pwt__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pwt__ b.34.2.1 (-) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus)} mgtgkelvlalydyqeksprevtmkkgdiltllnstnkdwwkvevndrqgfvpaayvkkl d
Timeline for d1pwt__: