Lineage for d2z51a2 (2z51 A:83-154)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947226Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 2947439Superfamily d.52.8: Fe-S cluster assembly (FSCA) domain-like [117916] (3 families) (S)
    similar putative active site with a conserved cysteine residue
  5. 2947471Family d.52.8.0: automated matches [191619] (1 protein)
    not a true family
  6. 2947472Protein automated matches [191134] (3 species)
    not a true protein
  7. 2947480Species Arabidopsis thaliana [255722] (1 PDB entry)
  8. 2947482Domain d2z51a2: 2z51 A:83-154 [244896]
    automated match to d1th5a1
    complexed with mg

Details for d2z51a2

PDB Entry: 2z51 (more details), 1.35 Å

PDB Description: crystal structure of arabidopsis cnfu involved in iron-sulfur cluster biosynthesis
PDB Compounds: (A:) NifU-like protein 2, chloroplast

SCOPe Domain Sequences for d2z51a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z51a2 d.52.8.0 (A:83-154) automated matches {Arabidopsis thaliana}
lelneeniekvleeirpyligtadgsldlveiedpivkiritgpaagvmtvrvavtqklr
ekipsiaavqli

SCOPe Domain Coordinates for d2z51a2:

Click to download the PDB-style file with coordinates for d2z51a2.
(The format of our PDB-style files is described here.)

Timeline for d2z51a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2z51a1