SCOPe 2.08: Domain d2z51a2: 2z51 A:83-154

Lineage for d2z51a2 (2z51 A:83-154)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
   core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta

4. Superfamily d.52.8: Fe-S cluster assembly (FSCA) domain-like [117916] (3 families)
   similar putative active site with a conserved cysteine residue

5. Family d.52.8.0: automated matches [191619] (1 protein)
   not a true family

6. Protein automated matches [191134] (3 species)
   not a true protein

7. Species Arabidopsis thaliana [255722] (1 PDB entry)

8. Domain d2z51a2: 2z51 A:83-154 [244896]
   automated match to d1th5a1
   complexed with mg

Details for d2z51a2

PDB Entry: 2z51, 1.35 Å

PDB Description: crystal structure of arabidopsis cnfu involved in iron-sulfur cluster biosynthesis

PDB Compounds: (A:) NifU-like protein 2, chloroplast

SCOPe Domain Sequences for d2z51a2:

Sequence; same for both SEQRES and ATOM records:

>d2z51a2 d.52.8.0 (A:83-154) automated matches {Arabidopsis thaliana}
lelneeniekvleeirpyligtadgsldlveiedpivkiritgpaagvmtvrvavtqklr
ekipsiaavqli

Timeline for d2z51a2:

• d2z51a2 first appeared in SCOPe 2.04
  
• d2z51a2 appears in SCOPe 2.07