| Class b: All beta proteins [48724] (180 folds) |
| Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
| Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
| Protein automated matches [190770] (51 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188939] (29 PDB entries) |
| Domain d2z4fa_: 2z4f A: [244894] automated match to d2wuha_ |
PDB Entry: 2z4f (more details)
SCOPe Domain Sequences for d2z4fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z4fa_ b.18.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
npaicryplgmsggqipdeditassqwsestaakygrldseegdgawcpeipvepddlke
flqidlhtlhfitlvgtqgrhagghgiefapmykinysrdgtrwiswrnrhgkqvldgns
npydiflkdleppivarfvrfipvtdhsmnvcmrvelygcv
Timeline for d2z4fa_: