![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
![]() | Superfamily a.104.1: Cytochrome P450 [48264] (2 families) ![]() |
![]() | Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
![]() | Protein automated matches [190847] (99 species) not a true protein |
![]() | Species Streptomyces sp. [TaxId:171258] [255721] (3 PDB entries) |
![]() | Domain d2z3ua_: 2z3u A: [244893] automated match to d3weca_ complexed with crr, edo, hem |
PDB Entry: 2z3u (more details), 2.4 Å
SCOPe Domain Sequences for d2z3ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z3ua_ a.104.1.0 (A:) automated matches {Streptomyces sp. [TaxId: 171258]} atlprfdlmgwdkkdiadpypvyrryreaapvhrtasgpgkpdtyyvftyddvvrvlsnr rlgrnarvasgdtdtapvpiptehralrtvvenwlvfldpphhtelrsllttefspsivt glrpriaelasalldrlraqrrpdlvegfaaplpilvisallgipeedhtwlranavalq easttrardgrgyaraeaasqeftryfrrevdrrggddrddlltllvrardtgsplsvdg ivgtcvhlltaghetttnflakavltlrahrdvldelrttpestpaaveelmrydppvqa vtrwayedirlgdhdiprgsrvvallgsanrdparfpdpdvldvhraaerqvgfglgihy clgatlaraeaeiglralldgipalgrgaheveyaddmvfhgptrllldlp
Timeline for d2z3ua_: