Lineage for d2z3ua_ (2z3u A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2331668Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2331669Protein automated matches [190847] (73 species)
    not a true protein
  7. 2332214Species Streptomyces sp. [TaxId:171258] [255721] (3 PDB entries)
  8. 2332219Domain d2z3ua_: 2z3u A: [244893]
    automated match to d3weca_
    complexed with crr, edo, hem

Details for d2z3ua_

PDB Entry: 2z3u (more details), 2.4 Å

PDB Description: Crystal Structure of Chromopyrrolic Acid Bound Cytochrome P450 StaP (CYP245A1)
PDB Compounds: (A:) cytochrome p450

SCOPe Domain Sequences for d2z3ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z3ua_ a.104.1.0 (A:) automated matches {Streptomyces sp. [TaxId: 171258]}
atlprfdlmgwdkkdiadpypvyrryreaapvhrtasgpgkpdtyyvftyddvvrvlsnr
rlgrnarvasgdtdtapvpiptehralrtvvenwlvfldpphhtelrsllttefspsivt
glrpriaelasalldrlraqrrpdlvegfaaplpilvisallgipeedhtwlranavalq
easttrardgrgyaraeaasqeftryfrrevdrrggddrddlltllvrardtgsplsvdg
ivgtcvhlltaghetttnflakavltlrahrdvldelrttpestpaaveelmrydppvqa
vtrwayedirlgdhdiprgsrvvallgsanrdparfpdpdvldvhraaerqvgfglgihy
clgatlaraeaeiglralldgipalgrgaheveyaddmvfhgptrllldlp

SCOPe Domain Coordinates for d2z3ua_:

Click to download the PDB-style file with coordinates for d2z3ua_.
(The format of our PDB-style files is described here.)

Timeline for d2z3ua_: