Lineage for d2z3td_ (2z3t D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2331668Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2331669Protein automated matches [190847] (68 species)
    not a true protein
  7. 2332214Species Streptomyces sp. [TaxId:171258] [255721] (3 PDB entries)
  8. 2332218Domain d2z3td_: 2z3t D: [244892]
    automated match to d3weca_
    complexed with edo, hem, imd

Details for d2z3td_

PDB Entry: 2z3t (more details), 1.9 Å

PDB Description: Crystal Structure of Substrate Free Cytochrome P450 StaP (CYP245A1)
PDB Compounds: (D:) cytochrome p450

SCOPe Domain Sequences for d2z3td_:

Sequence, based on SEQRES records: (download)

>d2z3td_ a.104.1.0 (D:) automated matches {Streptomyces sp. [TaxId: 171258]}
tlprfdlmgwdkkdiadpypvyrryreaapvhrtasgpgkpdtyyvftyddvvrvlsnrr
lgrnarvasgdtdtapvpiptehralrtvvenwlvfldpphhtelrsllttefspsivtg
lrpriaelasalldrlraqrrpdlvegfaaplpilvisallgipeedhtwlranavalqe
asttrardgrgyaraeaasqeftryfrrevdrrggddrddlltllvrardtgsplsvdgi
vgtcvhlltaghetttnflakavltlrahrdvldelrttpestpaaveelmrydppvqav
trwayedirlgdhdiprgsrvvallgsanrdparfpdpdvldvhraaerqvgfglgihyc
lgatlaraeaeiglralldgipalgrgaheveyaddmvfhgptrllldl

Sequence, based on observed residues (ATOM records): (download)

>d2z3td_ a.104.1.0 (D:) automated matches {Streptomyces sp. [TaxId: 171258]}
tlprfdlmgwdkkdiadpypvyrryreaapvhrtasgpgkpdtyyvftyddvvrvlsnrr
lgrnarvralrtvvenwlvfldpphhtelrsllttefspsivtglrpriaelasalldrl
raqrrpdlvegfaaplpilvisallgipeedhtwlranavalqeasttrargyaraeaas
qeftryfrrevddlltllvragsplsvdgivgtcvhlltaghetttnflakavltlrahr
dvldelrttpestpaaveelmrydppvqavtrwayedirlgdhdiprgsrvvallgsanr
dparfpdpdvldvhraaerqvgfglgihyclgatlaraeaeiglralldgipalgrgahe
veyaddmvfhgptrllldl

SCOPe Domain Coordinates for d2z3td_:

Click to download the PDB-style file with coordinates for d2z3td_.
(The format of our PDB-style files is described here.)

Timeline for d2z3td_: