SCOPe 2.06: Domain d2yyaa2: 2yya A:102-322

Lineage for d2yyaa2 (2yya A:102-322)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families)

5. Family d.142.1.0: automated matches [227184] (1 protein)
   not a true family

6. Protein automated matches [226904] (32 species)
   not a true protein

7. Species Aquifex aeolicus [TaxId:63363] [255713] (2 PDB entries)

8. Domain d2yyaa2: 2yya A:102-322 [244883]
   Other proteins in same PDB: d2yyaa1, d2yyaa3, d2yyab1, d2yyab3
   automated match to d1gsoa3

Details for d2yyaa2

PDB Entry: 2yya, 2.4 Å

PDB Description: Crystal structure of GAR synthetase from Aquifex aeolicus

PDB Compounds: (A:) Phosphoribosylamine--glycine ligase

SCOPe Domain Sequences for d2yyaa2:

Sequence; same for both SEQRES and ATOM records:

>d2yyaa2 d.142.1.0 (A:102-322) automated matches {Aquifex aeolicus [TaxId: 63363]}
skafaktfmkkygiptaryevftdfekakeyvekvgapivvkadglaagkgavvcetvek
aietldrflnkkifgksservvieeflegeeasyivmingdryvplptsqdhkrlldedk
gpntggmgaysptpvineevekrireeivervikglkeegiyyrgflyaglmitkegpkv
lefnvrlgdpeaqpilmrvkndfletllnfyegkdvhiked

Timeline for d2yyaa2:

• d2yyaa2 first appeared in SCOPe 2.04
  
• d2yyaa2 appears in SCOPe 2.05
  
• d2yyaa2 appears in SCOPe 2.07
  
• d2yyaa2 appears in the current release, SCOPe 2.08