| Class b: All beta proteins [48724] (180 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
| Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
| Protein automated matches [190824] (31 species) not a true protein |
| Species Escherichia coli [TaxId:562] [255718] (2 PDB entries) |
| Domain d2yxwb2: 2yxw B:171-335 [244879] Other proteins in same PDB: d2yxwa3, d2yxwb3 automated match to d3od3a2 complexed with c2o, cu, no3; mutant |
PDB Entry: 2yxw (more details), 1.5 Å
SCOPe Domain Sequences for d2yxwb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yxwb2 b.6.1.0 (B:171-335) automated matches {Escherichia coli [TaxId: 562]}
mlpkqwgiddvpvivqdkkfsadgqidyqldvmtaavgwfgdtlltngaiypqhaaprgw
lrlrllngcnarslnfatsdnrplyviasdggllpepvkvselpvlmgerfevlvevndn
kpfdlvtlpvsqmgmaiapfdkphpvmriqpiaisasgalpdtls
Timeline for d2yxwb2: