SCOPe 2.07: Domain d2yxvb2: 2yxv B:171-335

Lineage for d2yxvb2 (2yxv B:171-335)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.0: automated matches [191502] (1 protein)
   not a true family

6. Protein automated matches [190824] (29 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [255718] (2 PDB entries)

8. Domain d2yxvb2: 2yxv B:171-335 [244875]
   Other proteins in same PDB: d2yxva3, d2yxvb3
   automated match to d3od3a2
   complexed with c2o, cu, no3; mutant

Details for d2yxvb2

PDB Entry: 2yxv, 1.81 Å

PDB Description: the deletion mutant of multicopper oxidase cueo

PDB Compounds: (B:) Blue copper oxidase cueO

SCOPe Domain Sequences for d2yxvb2:

Sequence; same for both SEQRES and ATOM records:

>d2yxvb2 b.6.1.0 (B:171-335) automated matches {Escherichia coli [TaxId: 562]}
mlpkqwgiddvpvivqdkkfsadgqidyqldvmtaavgwfgdtlltngaiypqhaaprgw
lrlrllngcnarslnfatsdnrplyviasdggllpepvkvselpvlmgerfevlvevndn
kpfdlvtlpvsqmgmaiapfdkphpvmriqpiaisasgalpdtls

Timeline for d2yxvb2:

• d2yxvb2 first appeared in SCOPe 2.04
  
• d2yxvb2 appears in SCOPe 2.06
  
• d2yxvb2 appears in the current release, SCOPe 2.08