Lineage for d2yxvb2 (2yxv B:171-335)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2772201Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2772202Protein automated matches [190824] (31 species)
    not a true protein
  7. 2772408Species Escherichia coli [TaxId:562] [255718] (2 PDB entries)
  8. 2772416Domain d2yxvb2: 2yxv B:171-335 [244875]
    Other proteins in same PDB: d2yxva3, d2yxvb3
    automated match to d3od3a2
    complexed with c2o, cu, no3; mutant

Details for d2yxvb2

PDB Entry: 2yxv (more details), 1.81 Å

PDB Description: the deletion mutant of multicopper oxidase cueo
PDB Compounds: (B:) Blue copper oxidase cueO

SCOPe Domain Sequences for d2yxvb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yxvb2 b.6.1.0 (B:171-335) automated matches {Escherichia coli [TaxId: 562]}
mlpkqwgiddvpvivqdkkfsadgqidyqldvmtaavgwfgdtlltngaiypqhaaprgw
lrlrllngcnarslnfatsdnrplyviasdggllpepvkvselpvlmgerfevlvevndn
kpfdlvtlpvsqmgmaiapfdkphpvmriqpiaisasgalpdtls

SCOPe Domain Coordinates for d2yxvb2:

Click to download the PDB-style file with coordinates for d2yxvb2.
(The format of our PDB-style files is described here.)

Timeline for d2yxvb2: