SCOPe 2.08: Domain d2yxvb1: 2yxv B:30-170

Lineage for d2yxvb1 (2yxv B:30-170)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.0: automated matches [191502] (1 protein)
   not a true family

6. Protein automated matches [190824] (31 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [255718] (2 PDB entries)

8. Domain d2yxvb1: 2yxv B:30-170 [244874]
   Other proteins in same PDB: d2yxva3, d2yxvb3
   automated match to d1kv7a1
   complexed with c2o, cu, no3; mutant

Details for d2yxvb1

PDB Entry: 2yxv, 1.81 Å

PDB Description: the deletion mutant of multicopper oxidase cueo

PDB Compounds: (B:) Blue copper oxidase cueO

SCOPe Domain Sequences for d2yxvb1:

Sequence; same for both SEQRES and ATOM records:

>d2yxvb1 b.6.1.0 (B:30-170) automated matches {Escherichia coli [TaxId: 562]}
erptlpipdllttdarnriqltigagqstfggktattwgyngnllgpavklqrgkavtvd
iynqlteettlhwhglevpgevdggpqgiippggkrsvtlnvdqpaatcwfhphqhgktg
rqvamglaglvvieddeilkl

Timeline for d2yxvb1:

• d2yxvb1 first appeared in SCOPe 2.04
  
• d2yxvb1 appears in SCOPe 2.07