![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) ![]() dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
![]() | Family d.58.4.0: automated matches [191316] (1 protein) not a true family |
![]() | Protein automated matches [190081] (31 species) not a true protein |
![]() | Species Sulfolobus tokodaii [TaxId:273063] [230709] (7 PDB entries) |
![]() | Domain d2yx7a2: 2yx7 A:61-150 [244871] Other proteins in same PDB: d2yx7a1 automated match to d2pmha2 complexed with gln, mg; mutant |
PDB Entry: 2yx7 (more details), 2.05 Å
SCOPe Domain Sequences for d2yx7a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yx7a2 d.58.4.0 (A:61-150) automated matches {Sulfolobus tokodaii [TaxId: 273063]} ldyivitsvkakygknyhvelgnklaqipgvwgvyfvlgdndfivmaryktreefmekfl ervmsipeverastqvvvkiikespnivif
Timeline for d2yx7a2: