SCOPe 2.08: Domain d2yx7a2: 2yx7 A:61-150

Lineage for d2yx7a2 (2yx7 A:61-150)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.0: automated matches [191316] (1 protein)
   not a true family

6. Protein automated matches [190081] (33 species)
   not a true protein

7. Species Sulfolobus tokodaii [TaxId:273063] [230709] (7 PDB entries)

8. Domain d2yx7a2: 2yx7 A:61-150 [244871]
   Other proteins in same PDB: d2yx7a1
   automated match to d2pmha2
   complexed with gln, mg; mutant

Details for d2yx7a2

PDB Entry: 2yx7, 2.05 Å

PDB Description: crystals structure of t132a mutant of st1022 from sulfolobus tokodaii 7

PDB Compounds: (A:) 150aa long hypothetical transcriptional regulator

SCOPe Domain Sequences for d2yx7a2:

Sequence; same for both SEQRES and ATOM records:

>d2yx7a2 d.58.4.0 (A:61-150) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
ldyivitsvkakygknyhvelgnklaqipgvwgvyfvlgdndfivmaryktreefmekfl
ervmsipeverastqvvvkiikespnivif

Timeline for d2yx7a2:

• d2yx7a2 first appeared in SCOPe 2.04
  
• d2yx7a2 appears in SCOPe 2.07