Lineage for d1pnj__ (1pnj -)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 109314Fold b.34: SH3-like barrel [50036] (9 superfamilies)
  4. 109356Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 109357Family b.34.2.1: SH3-domain [50045] (20 proteins)
  6. 109497Protein Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain [50055] (2 species)
  7. 109498Species Cow (Bos taurus) [TaxId:9913] [50057] (2 PDB entries)
  8. 109499Domain d1pnj__: 1pnj - [24487]

Details for d1pnj__

PDB Entry: 1pnj (more details)

PDB Description: solution structure and ligand-binding site of the sh3 domain of the p85alpha subunit of phosphatidylinositol 3-kinase

SCOP Domain Sequences for d1pnj__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pnj__ b.34.2.1 (-) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Cow (Bos taurus)}
gsmsaegyqyralydykkereedidlhlgdiltvnkgslvalgfsdgqeakpeeigwlng
ynettgergdfpgtyveyigrkkisp

SCOP Domain Coordinates for d1pnj__:

Click to download the PDB-style file with coordinates for d1pnj__.
(The format of our PDB-style files is described here.)

Timeline for d1pnj__: