Lineage for d1pnj__ (1pnj -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.34: SH3-like barrel [50036] (7 superfamilies) Superfamily b.34.2: SH3-domain [50044] (1 family) 
Family b.34.2.1: SH3-domain [50045] (16 proteins) 
Protein Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain [50055] (2 species) 
Species Cow (Bos taurus) [TaxId:9913] [50057] (2 PDB entries) 
Domain d1pnj__: 1pnj - [24487]
Details for d1pnj__
PDB Entry: 1pnj (more details)
PDB Description: solution structure and ligand-binding site of the sh3 domain of the p85alpha subunit of phosphatidylinositol 3-kinase
SCOP Domain Sequences for d1pnj__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pnj__ b.34.2.1 (-) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Cow (Bos taurus)}
gsmsaegyqyralydykkereedidlhlgdiltvnkgslvalgfsdgqeakpeeigwlng
ynettgergdfpgtyveyigrkkisp
SCOP Domain Coordinates for d1pnj__:
Click to download the PDB-style file with coordinates for d1pnj__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pnj__:
- d1pnj__ appears in SCOP 1.57
- d1pnj__ appears in the current release, SCOPe 2.07, called d1pnja_
View in 3D