Lineage for d2ywcc1 (2ywc C:1-189)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1586636Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1589127Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 1589128Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins)
    contains a catalytic Cys-His-Glu triad
  6. 1589236Protein GMP synthetase [52319] (2 species)
  7. 1589242Species Thermus thermophilus HB8 [TaxId:300852] [255715] (2 PDB entries)
  8. 1589249Domain d2ywcc1: 2ywc C:1-189 [244862]
    Other proteins in same PDB: d2ywca2, d2ywca3, d2ywcb2, d2ywcb3, d2ywcc2, d2ywcc3, d2ywcd2, d2ywcd3
    automated match to d1gpma2
    complexed with xmp

Details for d2ywcc1

PDB Entry: 2ywc (more details), 2.2 Å

PDB Description: Crystal structure of GMP synthetase from Thermus thermophilus in complex with XMP
PDB Compounds: (C:) GMP synthase [glutamine-hydrolyzing]

SCOPe Domain Sequences for d2ywcc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ywcc1 c.23.16.1 (C:1-189) GMP synthetase {Thermus thermophilus HB8 [TaxId: 300852]}
mvlvldfgsqytrliarrlrelrafslilpgdapleevlkhrpqalilsggprsvfdpda
prpdprlfssglpllgicygmqllaqelggrveragraeygkalltrhegplfrglegev
qvwmshqdavtapppgwrvvaeteenpvaaiaspdgraygvqfhpevahtpkgmqilenf
lelagvkrd

SCOPe Domain Coordinates for d2ywcc1:

Click to download the PDB-style file with coordinates for d2ywcc1.
(The format of our PDB-style files is described here.)

Timeline for d2ywcc1: