Lineage for d2pni__ (2pni -)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58264Fold b.34: SH3-like barrel [50036] (9 superfamilies)
  4. 58293Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 58294Family b.34.2.1: SH3-domain [50045] (18 proteins)
  6. 58427Protein Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain [50055] (2 species)
  7. 58428Species Cow (Bos taurus) [TaxId:9913] [50057] (2 PDB entries)
  8. 58430Domain d2pni__: 2pni - [24486]

Details for d2pni__

PDB Entry: 2pni (more details)

PDB Description: solution structure and ligand-binding site of the sh3 domain of the p85alpha subunit of phosphatidylinositol 3-kinase

SCOP Domain Sequences for d2pni__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pni__ b.34.2.1 (-) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Cow (Bos taurus)}
gsmsaegyqyralydykkereedidlhlgdiltvnkgslvalgfsdgqeakpeeigwlng
ynettgergdfpgtyveyigrkkisp

SCOP Domain Coordinates for d2pni__:

Click to download the PDB-style file with coordinates for d2pni__.
(The format of our PDB-style files is described here.)

Timeline for d2pni__: