SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2pnia_ (2pni A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2045654Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2045783Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2045784Family b.34.2.1: SH3-domain [50045] (40 protein domains)
  6. 2046093Protein Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain [50055] (2 species)
  7. 2046094Species Cow (Bos taurus) [TaxId:9913] [50057] (2 PDB entries)
  8. 2046096Domain d2pnia_: 2pni A: [24486]

Details for d2pnia_

PDB Entry: 2pni (more details)

PDB Description: solution structure and ligand-binding site of the sh3 domain of the p85alpha subunit of phosphatidylinositol 3-kinase
PDB Compounds: (A:) phosphatidylinositol 3-kinase p85-alpha subunit sh3 domain

SCOPe Domain Sequences for d2pnia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pnia_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Cow (Bos taurus) [TaxId: 9913]}
gsmsaegyqyralydykkereedidlhlgdiltvnkgslvalgfsdgqeakpeeigwlng
ynettgergdfpgtyveyigrkkisp

SCOPe Domain Coordinates for d2pnia_:

Click to download the PDB-style file with coordinates for d2pnia_.
(The format of our PDB-style files is described here.)

Timeline for d2pnia_: