Lineage for d2ywbd3 (2ywb D:383-503)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2554114Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 2554133Superfamily d.52.2: GMP synthetase C-terminal dimerisation domain [54810] (2 families) (S)
    automatically mapped to Pfam PF00958
  5. 2554134Family d.52.2.1: GMP synthetase C-terminal dimerisation domain [54811] (1 protein)
  6. 2554135Protein GMP synthetase C-terminal dimerisation domain [54812] (2 species)
  7. 2554141Species Thermus thermophilus HB8 [TaxId:300852] [255717] (2 PDB entries)
  8. 2554145Domain d2ywbd3: 2ywb D:383-503 [244855]
    Other proteins in same PDB: d2ywba1, d2ywba2, d2ywbb1, d2ywbb2, d2ywbc1, d2ywbc2, d2ywbd1, d2ywbd2
    automated match to d1gpma3

Details for d2ywbd3

PDB Entry: 2ywb (more details), 2.1 Å

PDB Description: Crystal structure of GMP synthetase from Thermus thermophilus
PDB Compounds: (D:) GMP synthase [glutamine-hydrolyzing]

SCOPe Domain Sequences for d2ywbd3:

Sequence, based on SEQRES records: (download)

>d2ywbd3 d.52.2.1 (D:383-503) GMP synthetase C-terminal dimerisation domain {Thermus thermophilus HB8 [TaxId: 300852]}
gpglavrvlgevteerleilrraddiftsllrewglyekvaqalavltpvrsvgvagder
kygyvlalravttedfmtadwarlplefldeaarritrrvpeigrvvydltskppatiew
e

Sequence, based on observed residues (ATOM records): (download)

>d2ywbd3 d.52.2.1 (D:383-503) GMP synthetase C-terminal dimerisation domain {Thermus thermophilus HB8 [TaxId: 300852]}
gpglavrvlgevteerleilrraddiftsllrewglyekvaqalavltpvgyvlalravt
tedfmtadwarlplefldeaarritrrvpeigrvvydltskppatiewe

SCOPe Domain Coordinates for d2ywbd3:

Click to download the PDB-style file with coordinates for d2ywbd3.
(The format of our PDB-style files is described here.)

Timeline for d2ywbd3: