![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies) core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta |
![]() | Superfamily d.52.2: GMP synthetase C-terminal dimerisation domain [54810] (2 families) ![]() automatically mapped to Pfam PF00958 |
![]() | Family d.52.2.1: GMP synthetase C-terminal dimerisation domain [54811] (1 protein) |
![]() | Protein GMP synthetase C-terminal dimerisation domain [54812] (2 species) |
![]() | Species Thermus thermophilus HB8 [TaxId:300852] [255717] (2 PDB entries) |
![]() | Domain d2ywbd3: 2ywb D:383-503 [244855] Other proteins in same PDB: d2ywba1, d2ywba2, d2ywbb1, d2ywbb2, d2ywbc1, d2ywbc2, d2ywbd1, d2ywbd2 automated match to d1gpma3 |
PDB Entry: 2ywb (more details), 2.1 Å
SCOPe Domain Sequences for d2ywbd3:
Sequence, based on SEQRES records: (download)
>d2ywbd3 d.52.2.1 (D:383-503) GMP synthetase C-terminal dimerisation domain {Thermus thermophilus HB8 [TaxId: 300852]} gpglavrvlgevteerleilrraddiftsllrewglyekvaqalavltpvrsvgvagder kygyvlalravttedfmtadwarlplefldeaarritrrvpeigrvvydltskppatiew e
>d2ywbd3 d.52.2.1 (D:383-503) GMP synthetase C-terminal dimerisation domain {Thermus thermophilus HB8 [TaxId: 300852]} gpglavrvlgevteerleilrraddiftsllrewglyekvaqalavltpvgyvlalravt tedfmtadwarlplefldeaarritrrvpeigrvvydltskppatiewe
Timeline for d2ywbd3: