![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) ![]() share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
![]() | Family c.26.2.1: N-type ATP pyrophosphatases [52403] (9 proteins) |
![]() | Protein GMP synthetase, central domain [52404] (2 species) |
![]() | Species Thermus thermophilus HB8 [TaxId:300852] [255716] (2 PDB entries) |
![]() | Domain d2ywbd2: 2ywb D:190-382 [244854] Other proteins in same PDB: d2ywba1, d2ywba3, d2ywbb1, d2ywbb3, d2ywbc1, d2ywbc3, d2ywbd1, d2ywbd3 automated match to d1gpma1 |
PDB Entry: 2ywb (more details), 2.1 Å
SCOPe Domain Sequences for d2ywbd2:
Sequence, based on SEQRES records: (download)
>d2ywbd2 c.26.2.1 (D:190-382) GMP synthetase, central domain {Thermus thermophilus HB8 [TaxId: 300852]} wtpehvleellrevreragkdrvllavsggvdsstlalllakagvdhlavfvdhgllrlg ereevegalralgvnllvvdakerflkalkgvedpeekrkiigrefvaafsqvarergpf rflaqgtlypdviesagghgaakikshhnvgglpedlefellepfrllfkdevrelalll glpdtlrlrhpfp
>d2ywbd2 c.26.2.1 (D:190-382) GMP synthetase, central domain {Thermus thermophilus HB8 [TaxId: 300852]} wtpehvleellrevreragkdrvllavsggvdsstlalllakagvdhlavfvdhgllrlg ereevegalralgvnllvvdakerflkalkgvedpeekrkiigrefvaafsqvarergpf rflaqgtlypdvilefellepfrllfkdevrelalllglpdtlrlrhpfp
Timeline for d2ywbd2: