Lineage for d2ywbc1 (2ywb C:1-189)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2858750Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2858751Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins)
    contains a catalytic Cys-His-Glu triad
  6. 2858873Protein GMP synthetase [52319] (2 species)
  7. 2858879Species Thermus thermophilus HB8 [TaxId:300852] [255715] (2 PDB entries)
  8. 2858882Domain d2ywbc1: 2ywb C:1-189 [244850]
    Other proteins in same PDB: d2ywba2, d2ywba3, d2ywbb2, d2ywbb3, d2ywbc2, d2ywbc3, d2ywbd2, d2ywbd3
    automated match to d1gpma2

Details for d2ywbc1

PDB Entry: 2ywb (more details), 2.1 Å

PDB Description: Crystal structure of GMP synthetase from Thermus thermophilus
PDB Compounds: (C:) GMP synthase [glutamine-hydrolyzing]

SCOPe Domain Sequences for d2ywbc1:

Sequence, based on SEQRES records: (download)

>d2ywbc1 c.23.16.1 (C:1-189) GMP synthetase {Thermus thermophilus HB8 [TaxId: 300852]}
mvlvldfgsqytrliarrlrelrafslilpgdapleevlkhrpqalilsggprsvfdpda
prpdprlfssglpllgicygmqllaqelggrveragraeygkalltrhegplfrglegev
qvwmshqdavtapppgwrvvaeteenpvaaiaspdgraygvqfhpevahtpkgmqilenf
lelagvkrd

Sequence, based on observed residues (ATOM records): (download)

>d2ywbc1 c.23.16.1 (C:1-189) GMP synthetase {Thermus thermophilus HB8 [TaxId: 300852]}
mvlvldfgsqytrliarrlrelrafslilpgdapleevlkhrpqalilsggprsvfdpda
prpdprlfssglpllgicygmqllaqelggrveraygkalltrhegplfrglegevqvwm
shqdavtapppgwrvvaeteenpvaaiaspdgraygvqfhpevahtpkgmqilenflela
gvkrd

SCOPe Domain Coordinates for d2ywbc1:

Click to download the PDB-style file with coordinates for d2ywbc1.
(The format of our PDB-style files is described here.)

Timeline for d2ywbc1: