Lineage for d1pkta_ (1pkt A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2782862Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2783195Protein Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain [50055] (2 species)
  7. 2783199Species Human (Homo sapiens) [TaxId:9606] [50056] (3 PDB entries)
  8. 2783202Domain d1pkta_: 1pkt A: [24485]

Details for d1pkta_

PDB Entry: 1pkt (more details)

PDB Description: structure of the pi3k sh3 domain and analysis of the sh3 family
PDB Compounds: (A:) phosphatidylinositol 3-kinase p85-alpha subunit sh3 domain

SCOPe Domain Sequences for d1pkta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pkta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]}
egyqyralydykkereedidlhlgdiltvnkgslvalgfsdgqearpeeigwlngynett
gergdfpgtyveyigr

SCOPe Domain Coordinates for d1pkta_:

Click to download the PDB-style file with coordinates for d1pkta_.
(The format of our PDB-style files is described here.)

Timeline for d1pkta_: