SCOPe 2.08: Domain d1pkta_: 1pkt A:

Lineage for d1pkta_ (1pkt A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain [50055] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50056] (3 PDB entries)

8. Domain d1pkta_: 1pkt A: [24485]

Details for d1pkta_

PDB Entry: 1pkt

PDB Description: structure of the pi3k sh3 domain and analysis of the sh3 family

PDB Compounds: (A:) phosphatidylinositol 3-kinase p85-alpha subunit sh3 domain

SCOPe Domain Sequences for d1pkta_:

Sequence; same for both SEQRES and ATOM records:

>d1pkta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]}
egyqyralydykkereedidlhlgdiltvnkgslvalgfsdgqearpeeigwlngynett
gergdfpgtyveyigr

Timeline for d1pkta_:

• d1pkta_ first appeared (with stable ids) in SCOP 1.55, called d1pkt__
  
• d1pkta_ appears in SCOPe 2.07