Class g: Small proteins [56992] (98 folds) |
Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies) dimetal(zinc)-bound alpha+beta fold |
Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) |
Family g.50.1.0: automated matches [191482] (1 protein) not a true family |
Protein automated matches [190772] (6 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187998] (28 PDB entries) |
Domain d2yw8a_: 2yw8 A: [244843] automated match to d1hyja_ complexed with so4, zn |
PDB Entry: 2yw8 (more details), 3 Å
SCOPe Domain Sequences for d2yw8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yw8a_ g.50.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} kddeathcrqcekefsisrrkhhcrncghifcntcssnelalpsypkpvrvcdschtlll q
Timeline for d2yw8a_: