Lineage for d2yw8a_ (2yw8 A:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1707171Fold g.50: FYVE/PHD zinc finger [57902] (1 superfamily)
    dimetal(zinc)-bound alpha+beta fold
  4. 1707172Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) (S)
  5. 1707269Family g.50.1.0: automated matches [191482] (1 protein)
    not a true family
  6. 1707270Protein automated matches [190772] (3 species)
    not a true protein
  7. 1707273Species Human (Homo sapiens) [TaxId:9606] [187998] (19 PDB entries)
  8. 1707284Domain d2yw8a_: 2yw8 A: [244843]
    automated match to d1hyja_
    complexed with so4, zn

Details for d2yw8a_

PDB Entry: 2yw8 (more details), 3 Å

PDB Description: Crystal structure of human RUN and FYVE domain-containing protein
PDB Compounds: (A:) RUN and FYVE domain-containing protein 1

SCOPe Domain Sequences for d2yw8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yw8a_ g.50.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kddeathcrqcekefsisrrkhhcrncghifcntcssnelalpsypkpvrvcdschtlll
q

SCOPe Domain Coordinates for d2yw8a_:

Click to download the PDB-style file with coordinates for d2yw8a_.
(The format of our PDB-style files is described here.)

Timeline for d2yw8a_: