SCOPe 2.07: Domain d2yw2b3: 2yw2 B:323-423

Lineage for d2yw2b3 (2yw2 B:323-423)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families)

5. Family b.84.2.0: automated matches [254217] (1 protein)
   not a true family

6. Protein automated matches [254496] (16 species)
   not a true protein

7. Species Aquifex aeolicus [TaxId:63363] [255714] (2 PDB entries)

8. Domain d2yw2b3: 2yw2 B:323-423 [244841]
   Other proteins in same PDB: d2yw2a1, d2yw2a2, d2yw2b1, d2yw2b2
   automated match to d1gsoa1
   complexed with atp, po4

Details for d2yw2b3

PDB Entry: 2yw2, 1.8 Å

PDB Description: Crystal structure of GAR synthetase from Aquifex aeolicus in complex with ATP

PDB Compounds: (B:) Phosphoribosylamine--glycine ligase

SCOPe Domain Sequences for d2yw2b3:

Sequence; same for both SEQRES and ATOM records:

>d2yw2b3 b.84.2.0 (B:323-423) automated matches {Aquifex aeolicus [TaxId: 63363]}
eryaldvvlasrgypekpetgkiihgldylksmedvvvfhagtkkegnftvtsggrvlnv
caygktlkeakerayeairyvcfegmhyrkdigdkafkyls

Timeline for d2yw2b3:

• d2yw2b3 first appeared in SCOPe 2.04
  
• d2yw2b3 appears in SCOPe 2.06
  
• d2yw2b3 appears in the current release, SCOPe 2.08