SCOPe 2.04: Domain d2yuqa_: 2yuq A:

Lineage for d2yuqa_ (2yuq A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein automated matches [190043] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187799] (23 PDB entries)

8. Domain d2yuqa_: 2yuq A: [244832]
   automated match to d1awja_

Details for d2yuqa_

PDB Entry: 2yuq

PDB Description: solution structure of the sh3 domain of human tyrosine-protein kinase itk/tsk

PDB Compounds: (A:) Tyrosine-protein kinase ITK/TSK

SCOPe Domain Sequences for d2yuqa_:

Sequence; same for both SEQRES and ATOM records:

>d2yuqa_ b.34.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssgssgednrrplwepeetvvialydyqtndpqelalrrneeyclldsseihwwrvqdr
nghegyvpssylvekspnnletyew

Timeline for d2yuqa_:

• d2yuqa_ is new in SCOPe 2.04-stable
  
• d2yuqa_ appears in SCOPe 2.05
  
• d2yuqa_ appears in the current release, SCOPe 2.08, called d2yuqa1