![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.21: HMG-box [47094] (1 superfamily) 3 helices; irregular array |
![]() | Superfamily a.21.1: HMG-box [47095] (2 families) ![]() |
![]() | Family a.21.1.0: automated matches [191668] (1 protein) not a true family |
![]() | Protein automated matches [191268] (4 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189843] (5 PDB entries) |
![]() | Domain d2yula_: 2yul A: [244827] automated match to d2lefa_ |
PDB Entry: 2yul (more details)
SCOPe Domain Sequences for d2yula_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yula_ a.21.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gssgssgirrpmnafmvwakderkrlaqqnpdlhnaelskmlgkswkaltlaekrpfvee aerlrvqhmqdhpnyksgpssg
Timeline for d2yula_: