Lineage for d2yula_ (2yul A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1725579Fold a.21: HMG-box [47094] (1 superfamily)
    3 helices; irregular array
  4. 1725580Superfamily a.21.1: HMG-box [47095] (2 families) (S)
  5. 1725656Family a.21.1.0: automated matches [191668] (1 protein)
    not a true family
  6. 1725657Protein automated matches [191268] (4 species)
    not a true protein
  7. 1725660Species Human (Homo sapiens) [TaxId:9606] [189843] (5 PDB entries)
  8. 1725665Domain d2yula_: 2yul A: [244827]
    automated match to d2lefa_

Details for d2yula_

PDB Entry: 2yul (more details)

PDB Description: solution structure of the hmg box of human transcription factor sox-17
PDB Compounds: (A:) Transcription factor SOX-17

SCOPe Domain Sequences for d2yula_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yula_ a.21.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssgssgirrpmnafmvwakderkrlaqqnpdlhnaelskmlgkswkaltlaekrpfvee
aerlrvqhmqdhpnyksgpssg

SCOPe Domain Coordinates for d2yula_:

Click to download the PDB-style file with coordinates for d2yula_.
(The format of our PDB-style files is described here.)

Timeline for d2yula_: