Lineage for d2yula1 (2yul A:8-76)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2310163Fold a.21: HMG-box [47094] (1 superfamily)
    3 helices; irregular array
  4. 2310164Superfamily a.21.1: HMG-box [47095] (2 families) (S)
  5. 2310241Family a.21.1.0: automated matches [191668] (1 protein)
    not a true family
  6. 2310242Protein automated matches [191268] (4 species)
    not a true protein
  7. 2310245Species Human (Homo sapiens) [TaxId:9606] [189843] (6 PDB entries)
  8. 2310250Domain d2yula1: 2yul A:8-76 [244827]
    Other proteins in same PDB: d2yula2, d2yula3
    automated match to d2lefa_

Details for d2yula1

PDB Entry: 2yul (more details)

PDB Description: Solution structure of the HMG box of human Transcription factor SOX-17
PDB Compounds: (A:) Transcription factor SOX-17

SCOPe Domain Sequences for d2yula1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yula1 a.21.1.0 (A:8-76) automated matches {Human (Homo sapiens) [TaxId: 9606]}
irrpmnafmvwakderkrlaqqnpdlhnaelskmlgkswkaltlaekrpfveeaerlrvq
hmqdhpnyk

SCOPe Domain Coordinates for d2yula1:

Click to download the PDB-style file with coordinates for d2yula1.
(The format of our PDB-style files is described here.)

Timeline for d2yula1: