![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
![]() | Superfamily a.2.3: Chaperone J-domain [46565] (2 families) ![]() |
![]() | Family a.2.3.0: automated matches [191473] (1 protein) not a true family |
![]() | Protein automated matches [190750] (8 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [255094] (10 PDB entries) |
![]() | Domain d2yuaa1: 2yua A:8-93 [244825] Other proteins in same PDB: d2yuaa2, d2yuaa3 automated match to d2o37a_ |
PDB Entry: 2yua (more details)
SCOPe Domain Sequences for d2yuaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yuaa1 a.2.3.0 (A:8-93) automated matches {Human (Homo sapiens) [TaxId: 9606]} sqgdcsysrtalydllgvpstatqaqikaayyrqcflyhpdrnsgsaeaaerftrisqay vvlgsatlrrkydrgllsdedlrgpg
Timeline for d2yuaa1: