Lineage for d2yuaa1 (2yua A:8-93)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2689868Superfamily a.2.3: Chaperone J-domain [46565] (2 families) (S)
  5. 2689904Family a.2.3.0: automated matches [191473] (1 protein)
    not a true family
  6. 2689905Protein automated matches [190750] (8 species)
    not a true protein
  7. 2689916Species Human (Homo sapiens) [TaxId:9606] [255094] (10 PDB entries)
  8. 2689926Domain d2yuaa1: 2yua A:8-93 [244825]
    Other proteins in same PDB: d2yuaa2, d2yuaa3
    automated match to d2o37a_

Details for d2yuaa1

PDB Entry: 2yua (more details)

PDB Description: solution structure of the dnaj domain from human williams-beuren syndrome chromosome region 18 protein
PDB Compounds: (A:) Williams-Beuren syndrome chromosome region 18 protein

SCOPe Domain Sequences for d2yuaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yuaa1 a.2.3.0 (A:8-93) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sqgdcsysrtalydllgvpstatqaqikaayyrqcflyhpdrnsgsaeaaerftrisqay
vvlgsatlrrkydrgllsdedlrgpg

SCOPe Domain Coordinates for d2yuaa1:

Click to download the PDB-style file with coordinates for d2yuaa1.
(The format of our PDB-style files is described here.)

Timeline for d2yuaa1: