SCOPe 2.05: Domain d2yt8a_: 2yt8 A:

Lineage for d2yt8a_ (2yt8 A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein automated matches [190055] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187785] (42 PDB entries)

8. Domain d2yt8a_: 2yt8 A: [244824]
   automated match to d1y7na1

Details for d2yt8a_

PDB Entry: 2yt8

PDB Description: solution structure of the pdz domain of amyloid beta a4 precursor protein-binding family a member 3 (neuron- specific x11l2 protein) (neuronal munc18-1-interacting protein 3) (mint-3) (adapter protein x11gamma)

PDB Compounds: (A:) Amyloid beta A4 precursor protein-binding family A member 3

SCOPe Domain Sequences for d2yt8a_:

Sequence; same for both SEQRES and ATOM records:

>d2yt8a_ b.36.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssgssgvttaiihrphareqlgfcvedgiicsllrggiaerggirvghriieingqsvv
atphariiellteaygevhiktmpaatyrlltgq

Timeline for d2yt8a_:

• d2yt8a_ first appeared in SCOPe 2.04
  
• d2yt8a_ is called d2yt8a1 in SCOPe 2.06
  
• d2yt8a_ appears in the current release, SCOPe 2.08, called d2yt8a1