Lineage for d1awo__ (1awo -)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58264Fold b.34: SH3-like barrel [50036] (9 superfamilies)
  4. 58293Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 58294Family b.34.2.1: SH3-domain [50045] (18 proteins)
  6. 58298Protein Abl tyrosine kinase, SH3 domain [50052] (2 species)
  7. 58299Species Human (Homo sapiens) [TaxId:9606] [50054] (3 PDB entries)
  8. 58305Domain d1awo__: 1awo - [24482]

Details for d1awo__

PDB Entry: 1awo (more details)

PDB Description: the solution nmr structure of abl sh3 and its relationship to sh2 in the sh(32) construct, 20 structures

SCOP Domain Sequences for d1awo__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1awo__ b.34.2.1 (-) Abl tyrosine kinase, SH3 domain {Human (Homo sapiens)}
slfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsnyitpvs

SCOP Domain Coordinates for d1awo__:

Click to download the PDB-style file with coordinates for d1awo__.
(The format of our PDB-style files is described here.)

Timeline for d1awo__: