SCOPe 2.08: Domain d1awoa1: 1awo A:65-119

Lineage for d1awoa1 (1awo A:65-119)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein Abl tyrosine kinase, SH3 domain [50052] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50054] (6 PDB entries)

8. Domain d1awoa1: 1awo A:65-119 [24482]
   Other proteins in same PDB: d1awoa2, d1awoa3

Details for d1awoa1

PDB Entry: 1awo

PDB Description: the solution nmr structure of abl sh3 and its relationship to sh2 in the sh(32) construct, 20 structures

PDB Compounds: (A:) abl tyrosine kinase

SCOPe Domain Sequences for d1awoa1:

Sequence; same for both SEQRES and ATOM records:

>d1awoa1 b.34.2.1 (A:65-119) Abl tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]}
lfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsnyitpv

Timeline for d1awoa1:

• d1awoa1 first appeared (with stable ids) in SCOP 1.55, called d1awo__
  
• d1awoa1 was called d1awoa_ in SCOPe 2.07