SCOPe 2.06: Domain d2yswa_: 2ysw A:

Lineage for d2yswa_ (2ysw A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.0: automated matches [191319] (1 protein)
   not a true family

6. Protein automated matches [190115] (75 species)
   not a true protein

7. Species Aquifex aeolicus [TaxId:63363] [187668] (3 PDB entries)

8. Domain d2yswa_: 2ysw A: [244819]
   automated match to d2egzc_

Details for d2yswa_

PDB Entry: 2ysw, 2.25 Å

PDB Description: Crystal Structure of the 3-dehydroquinate dehydratase from Aquifex aeolicus VF5

PDB Compounds: (A:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d2yswa_:

Sequence; same for both SEQRES and ATOM records:

>d2yswa_ c.1.10.0 (A:) automated matches {Aquifex aeolicus [TaxId: 63363]}
mliavplddtnfsenlkkakekgadivelrvdqfsdtslnyvkekleevhsqglktilti
rspeeggrevknreelfeelsplsdytdielssrgllvklynitkeagkkliisyhnfel
tppnwiirevlregyryggipkiavkansyedvarllcisrqvegekilismgdygkisr
lagyvfgsvitycslekafapgqipleemvelrkkfyrl

Timeline for d2yswa_:

• d2yswa_ first appeared in SCOPe 2.04
  
• d2yswa_ appears in SCOPe 2.05
  
• d2yswa_ appears in SCOPe 2.07
  
• d2yswa_ appears in the current release, SCOPe 2.08